PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_92.68
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 671aa    MW: 72988.6 Da    PI: 6.5825
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_92.68genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.31.6e-13237299163
                                  XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                       bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                  e+e kr  r+++NRe+A+ sRqRKk ++eeLe+kv ++ +   +L ++++    e a+l++++
  evm.model.supercontig_92.68 237 EEEEKRKARLMRNRESAQLSRQRKKHYVEELEDKVRTMHSTIADLNSKISYFMAENATLRQQL 299
                                  6899****************************************************9999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001702.6E-12237299IPR004827Basic-leucine zipper domain
SMARTSM003382.9E-17237301IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.473239299IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.8E-18241300No hitNo description
SuperFamilySSF579592.33E-12241299No hitNo description
CDDcd147041.39E-22242293No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 671 aa     Download sequence    Send to blast
MAEQLLTEQP PAPDTNHTFC SEFDTLPVPP LDPLFLPGSD YTTNDNLKAD LGFGFEEDGD  60
IELTFDDLDD LYFPSETEPF IIPVSAQAKS SQGCSGNFNP ESGGFGISGD HSVDVVDSYM  120
NWWSPESVSC DRGYPKVQSS QDSGDGCPEA TTSMNFPSPA SSHGSGVSEA VNTSSADSRN  180
PVVDEKIKVK EIGKNSVTKR KKDSEDATGE SRTNKFRRSF VPSENTNSDE VSVTTNEEEE  240
KRKARLMRNR ESAQLSRQRK KHYVEELEDK VRTMHSTIAD LNSKISYFMA ENATLRQQLS  300
GGAGICPPPP GMYSPMAPMP YPWMPCPPYV VKSQGSQVPL VPIPRLKPQQ PVSASKPKKG  360
ESKKGVSRTK KVASISFLGL LFFIVLFGGL IPVINVKYGG TYDNVDIVSG YVNDRFYDQH  420
RGRVLTVSSQ SNGSDKNIGI GFSKVNFDTS NRIHYKRGHS GGSSDGADPE DGRSSSKENV  480
PLGNSSESLV ASLYVPRNDK LVKIDGNLII HSVLASEKAM ASRKDNRETG LAIPTALAIP  540
DVRRSGRIHS HLYRSANERQ KALSSGSTNT LKDHFKSSAA DGKLQQWFRE GVADGMQPSA  600
QKDNFPGNKS ASSMVVSILV DPREAGDADI DGMIAPKSLS RIFVVVLMDS VKYVTYSCVL  660
PRSSPHLVTA *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006430509.11e-178hypothetical protein CICLE_v10011169mg
SwissprotO222081e-151BZP17_ARATH; bZIP transcription factor 17
TrEMBLV4UVN21e-178V4UVN2_9R
STRINGscaffold_402899.11e-153(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Representative plantOGRP21711628
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-141bZIP family protein